PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06864.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 794aa    MW: 87161.2 Da    PI: 7.8429
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06864.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-095986351954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  KHN06864.1 598 FEHflHPYPTDTDKHMLASQTGLSRNQVSNWFINARVR 635
                 665559******************************87 PP

2BELL96.91.8e-31452520472
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 + q kkakLl ++eeV ++ kqy+ q+q+v+ssFe vaglgsa+pY+ +Alk +S+hFrc k+ i+eq+
  KHN06864.1 452 DYQHKKAKLLYMQEEVTRQCKQYHLQMQMVVSSFESVAGLGSATPYIPMALKSVSKHFRCFKNSISEQL 520
                 789****************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-41358518IPR006563POX domain
PfamPF075261.6E-39363517IPR006563POX domain
PROSITE profilePS5007112.001576639IPR001356Homeobox domain
SMARTSM003895.0E-9579643IPR001356Homeobox domain
CDDcd000861.65E-11579640No hitNo description
SuperFamilySSF466896.42E-17581646IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-27582643IPR009057Homeodomain-like
PfamPF059203.6E-18596635IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MSNLRPESHV AQQIRREKLR IQNSSQPSHE FPNNLEQLSL HPAGGFNNLD LLQVRSVRNA  60
NILDGLAVYS SEMPNFSTSS SNPNLSDARN ALEYHQEQGA AAEPSNRLMM NQYGSFPHSM  120
SAIHSSHKEH CELRNLGNWR NSAPHQGSDW FVNYASNANS FLSADLNNNV SAYNELMDVH  180
CSNASGEISG REIQKQLGVL HNNPPPSPLY QNALQDIVKS ASFSSHTRQD MSSLMQQNDH  240
SIWVGNAGEA EPQQPSYENQ PNQLHFGWTN RTIANTLSDS TPQSLSLSLS SNAQPKPSVS  300
HLEQGSASDD PQCLTNMKSI VKPSIVSRDI GKSVQETVGM PSKSTITYRS VGPLGPFTGY  360
ATILKSSRFL KSAQQLLDEI CCLSGAKFAK SYDVSKRVSP EVSASTSADT VTGVAAKGSN  420
SGSSSSILYS VSKENRADPG VRSSFGLSSR PDYQHKKAKL LYMQEEVTRQ CKQYHLQMQM  480
VVSSFESVAG LGSATPYIPM ALKSVSKHFR CFKNSISEQL KLISEALGED LSKPSNTSTC  540
SNKADTTTTK ARIRCSIDQS FLKNKSVKGT TELLEQHVWR PQRGLPERAV AILKAWLFEH  600
FLHPYPTDTD KHMLASQTGL SRNQVSNWFI NARVRVWKPM VEEIHTLETK ATSSKGNCGK  660
NEGTSSGTEG DTSNPRALSN IGMNSIPENQ FQGMDMGSSI IAANAEESGL NSEQWSQEKR  720
SKLECQMTTS NMDGTLMGFV PYRRGGGIEV GGLGSVSLTL GLRHGVEGVQ HQQQLQEEQL  780
RHHLGGHMIH DFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15585643563Homeobox protein Meis2
3k2a_B1e-15585643563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592709.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_014620473.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA0A0B2PGR90.0A0A0B2PGR9_GLYSO; BEL1-like homeodomain protein 8
TrEMBLK7LVK30.0K7LVK3_SOYBN; Uncharacterized protein
STRINGGLYMA12G29991.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.18e-76BEL1-like homeodomain 8
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]